Xenopus laevis (African clawed frog): 108712520 Help Entry 108712520         CDS       T01010                                  Symbol krasl.S Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism xla  Xenopus laevis (African clawed frog) Pathway xla04010   MAPK signaling pathway xla04012   ErbB signaling pathway xla04068   FoxO signaling pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04150   mTOR signaling pathway xla04210   Apoptosis xla04218   Cellular senescence xla04370   VEGF signaling pathway xla04371   Apelin signaling pathway xla04540   Gap junction xla04625   C-type lectin receptor signaling pathway xla04810   Regulation of actin cytoskeleton xla04910   Insulin signaling pathway xla04912   GnRH signaling pathway xla04914   Progesterone-mediated oocyte maturation xla04916   Melanogenesis Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     108712520 (krasl.S)    04150 mTOR signaling pathway     108712520 (krasl.S)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108712520 (krasl.S)    04137 Mitophagy - animal     108712520 (krasl.S)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     108712520 (krasl.S)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:xla04031]     108712520 (krasl.S) Membrane trafficking [BR:xla04131]  Endocytosis   Macropinocytosis    Ras GTPases     108712520 (krasl.S) GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108712520 (krasl.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin AAA_14 nSTAND3 Motif Other DBs NCBI-GeneID:  108712520 NCBI-ProteinID:  XP_041443778 Xenbase:  XB-GENE-22063561 UniProt:  A0A8J1MQX2 LinkDB All DBs Position 3S:complement(1179207..1188691) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQFRLTKMSKEEKTPGC VKFKKCRVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggttggtgctggaggtgtagggaagagtgccctgacc attcagctcatccagaatcattttgtggatgaatatgatcccaccatagaggactcgtat aggaaacaagtggtgatcgatggggagacgtgtctgttggacattctggacactgcgggg caggaggaatacagtgcaatgcgggaccagtatatgaggaccggcgagggcttcctctgt gtctttgccattaataacatcaagtcctttgaggatattcaccattatagagagcagatc aagcgagtgaaggattcggaggacgtgccgatggttctggtggggaacaagtgcgacttg ccctcccggacggtggacaccaaacaagcccaggacttggccaggagttacgggattcct tttatcgagacctcggccaaaaccagacagagagtggaggatgctttttatacattggtg agagaaatccggcagttcagattgacaaagatgagcaaagaagaaaagactccgggatgt gtgaaatttaaaaaatgtcgggtaatgtga

DBGET integrated database retrieval system