Xenopus laevis (African clawed frog): 108712798 Help Entry 108712798         CDS       T01010                                  Symbol calml4.S Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism xla  Xenopus laevis (African clawed frog) Pathway xla04020   Calcium signaling pathway xla04070   Phosphatidylinositol signaling system xla04114   Oocyte meiosis xla04218   Cellular senescence xla04261   Adrenergic signaling in cardiomyocytes xla04270   Vascular smooth muscle contraction xla04371   Apelin signaling pathway xla04625   C-type lectin receptor signaling pathway xla04744   Phototransduction xla04910   Insulin signaling pathway xla04912   GnRH signaling pathway xla04916   Melanogenesis Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     108712798 (calml4.S)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:xla01009]     108712798 (calml4.S)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     108712798 (calml4.S)    03036 Chromosome and associated proteins [BR:xla03036]     108712798 (calml4.S)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     108712798 (calml4.S) Protein phosphatases and associated proteins [BR:xla01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108712798 (calml4.S) Membrane trafficking [BR:xla04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108712798 (calml4.S) Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108712798 (calml4.S) Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108712798 (calml4.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 DUF5580_M Motif Other DBs NCBI-GeneID:  108712798 NCBI-ProteinID:  XP_018110726 Xenbase:  XB-GENE-17337199 UniProt:  A0A1L8GSE0 A0A974D7A6 LinkDB All DBs Position 3S:36444702..36454061 Genome browser AA seq 153 aa AA seqDB search MAKFLSQDEIQKYKECFSLYDKKGKGKIPAGDLLIVMRCLGTCPTPGEVTRHLQVHKIGK DGEVDFSTFLAIIYRQQKQQDPENEIMVAMLMSDKQKKGVIPLTELRAKLTQMGEKLTPN EVDDLLKGVKVGPDGMVKYEEFVRNVTLPMPDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagtttctgtctcaggatgaaattcaaaagtacaaggaatgtttttctctctat gataagaaaggcaaaggtaaaatcccggccggggaccttctgattgtcatgcgatgcctg ggaacctgtcccacacctggggaggtcacacgacacctacaggtccacaaaatcggcaag gatggggaagtggacttttccaccttcttagcaatcatataccggcagcagaagcagcag gacccagagaacgagatcatggtggccatgttaatgtcggacaagcagaagaaaggagtc atcccactgacagaactcagagccaaactcactcagatgggggagaagctcacacccaat gaagttgatgatctcctaaaaggtgttaaagtcggaccagatgggatggtgaaatatgaa gagtttgtaaggaatgtcacacttcctatgcctgactactga

DBGET integrated database retrieval system