Xenopus laevis (African clawed frog): 108718266 Help Entry 108718266         CDS       T01010                                  Symbol pfn4.S Name (RefSeq) profilin-4   KO K05759   profilin Organism xla  Xenopus laevis (African clawed frog) Pathway xla04810   Regulation of actin cytoskeleton xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108718266 (pfn4.S)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108718266 (pfn4.S)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     108718266 (pfn4.S)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:xla04812]     108718266 (pfn4.S)    04147 Exosome [BR:xla04147]     108718266 (pfn4.S) Membrane trafficking [BR:xla04131]  Others   Actin-binding proteins    Others     108718266 (pfn4.S) Cytoskeleton proteins [BR:xla04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      108718266 (pfn4.S) Exosome [BR:xla04147]  Exosomal proteins   Proteins found in most exosomes    108718266 (pfn4.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  108718266 NCBI-ProteinID:  XP_018121469 Xenbase:  XB-GENE-6488432 UniProt:  A0A8J0VGN9 LinkDB All DBs Position 5S:complement(133218147..133227510) Genome browser AA seq 128 aa AA seqDB search MNQIQNLLYDSLIKTQHVEAAALIRIKEGVVFPSPPRFQVQAQTIKTIVDAFKNTSAIRK EGLQFWDKTYQCVRADKNSIYAKCDEGGLVLVKTKSNILLATYREGMYPSVCVEAAEKLG SYFREKEI NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgaaccagatccagaatttgctgtacgactcgctgataaagactcagcatgtggaggct gcagctctcataaggataaaagagggtgttgtgttcccttcacccccgcgctttcaggta caagcacagacaataaaaactatagtagacgcctttaagaacacatctgcaataaggaag gaagggcttcagttttgggacaagacctaccaatgtgttcgggctgataaaaattccatc tatgcaaaatgtgatgaagggggacttgtattggtaaagacaaagtcgaatattctactt gcgacttaccgggaaggcatgtaccccagtgtgtgtgtagaggctgctgagaaattaggt tcttatttcagggagaaagaaatatga

DBGET integrated database retrieval system