Xenopus laevis (African clawed frog): 121397099 Help Entry 121397099         CDS       T01010                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism xla  Xenopus laevis (African clawed frog) Pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04144   Endocytosis xla04145   Phagosome xla04148   Efferocytosis xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121397099    04145 Phagosome     121397099    04140 Autophagy - animal     121397099    04137 Mitophagy - animal     121397099    04148 Efferocytosis     121397099  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121397099  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     121397099   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     121397099    04031 GTP-binding proteins [BR:xla04031]     121397099 Membrane trafficking [BR:xla04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121397099 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121397099   Exosomal proteins of other body fluids (saliva and urine)    121397099   Exosomal proteins of colorectal cancer cells    121397099   Exosomal proteins of bladder cancer cells    121397099 GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121397099 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU G-alpha ATP_bind_1 RsgA_GTPase cobW FeoB_N AAA_29 AAA_7 GIY_YIG_2 AAA_16 DAP3 AAA_lid_7 AAA_22 MCM CoaE Motif Other DBs NCBI-GeneID:  121397099 NCBI-ProteinID:  XP_041429172 UniProt:  A0A8J1LI15 LinkDB All DBs Position 8L:12396842..12407492 Genome browser AA seq 199 aa AA seqDB search MFHRKHIKLLLIGNAGSGKSALMNQYVNCRFTNYYRATIGADFFTKELRVNEKIVTVQIW DTAGTERFQSLGAALYRGTDCCLLVFDVSSPNSFHALDNWHREFLVQADPVSPGSFPFVV IGNKTDLEERQVSPREVEEWCKRFNAKYFETSAKEARNVEEAFLEAIKLGLNYHQEPDQT WDTKVVNLSPPSNSKKCDC NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgttccacaggaagcacatcaagcttcttctcattgggaatgcaggatcaggaaagtca gcattgatgaaccaatacgtcaactgtcggtttaccaactactacagagcaactattgga gcagatttcttcactaaggagctacgggttaatgagaagatagtgacagtgcagatatgg gacacagcgggaacagagcgattccagtcattgggtgctgctctctatagaggcacagac tgttgcctgttggtgtttgatgtgagctcccctaactccttccatgctctggacaactgg cacagagagttcctggtacaagccgatcccgtttctcctggaagcttcccgttcgtggtg atcggtaataagacagacctagaggagcggcaggtttcaccgcgggaggtagaggaatgg tgtaaaaggttcaacgcaaagtactttgaaaccagcgctaaggaagcaaggaacgtagag gaggcattcctggaggccatcaaattgggcttaaactatcaccaggagcctgaccagacc tgggataccaaggtagtgaacttgtctcctccgagcaatagcaagaaatgtgactgttag

DBGET integrated database retrieval system