Xenopus laevis (African clawed frog): 121398073 Help Entry 121398073         CDS       T01010                                  Name (RefSeq) histone H2A type 1-like   KO K11251   histone H2A Organism xla  Xenopus laevis (African clawed frog) Pathway xla03082   ATP-dependent chromatin remodeling xla04217   Necroptosis Brite KEGG Orthology (KO) [BR:xla00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121398073  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121398073  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xla03036]     121398073   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     121398073 Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121398073 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121398073 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121398073 NCBI-ProteinID:  XP_041432557 UniProt:  A0A1L8G0S2 LinkDB All DBs Position 9_10L:complement(134321506..134321996) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKK TESSKSAKSK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggtagaggcaaacaaggagggaaaacccgtgccaaggcaaagactcgctcatct cgtgctgggctgcaattcccagttggtcgtgttcatcgtctgttgaggaaaggcaattat gctgaacgggtgggagccggagctccggtctatttggctgcagtgctcgagtatctgact gctgagatcctggaattggctgggaacgctgcccgagataacaaaaagacccgtattatc cccaggcacctgcagctcgctgtgcgcaacgatgaggaattgaacaaactgctcggagga gtcactatcgctcagggtggagtcctgcccaacatccagtccgtgctgctgcccaagaaa accgagagttcaaagtccgctaagagcaagtga

DBGET integrated database retrieval system