Xenopus laevis (African clawed frog): 378696 Help Entry 378696            CDS       T01010                                  Symbol ins.S, ins-a, ins-b, ins1, ins1-a, xins Name (RefSeq) insulin-1 precursor   KO K04526   insulin Organism xla  Xenopus laevis (African clawed frog) Pathway xla04010   MAPK signaling pathway xla04068   FoxO signaling pathway xla04081   Hormone signaling xla04114   Oocyte meiosis xla04140   Autophagy - animal xla04150   mTOR signaling pathway xla04810   Regulation of actin cytoskeleton xla04910   Insulin signaling pathway xla04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     378696 (ins.S)    04150 mTOR signaling pathway     378696 (ins.S)   09133 Signaling molecules and interaction    04081 Hormone signaling     378696 (ins.S)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     378696 (ins.S)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xla04052]     378696 (ins.S) Cytokines and neuropeptides [BR:xla04052]  Neuropeptides   Unclassified    378696 (ins.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  378696 NCBI-ProteinID:  NP_001079351 Xenbase:  XB-GENE-6252363 UniProt:  P12706 A0A1L8GD41 A0A974CYS3 LinkDB All DBs Position 4S:7409236..7413687 Genome browser AA seq 106 aa AA seqDB search MALWMQCLPLVLVLFFSTPNTEALVNQHLCGSHLVEALYLVCGDRGFFYYPKVKRDMEQA LVSGPQDNELDGMQLQPQEYQKMKRGIVEQCCHSTCSLFQLESYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctctatggatgcagtgtctgcccctggttcttgtcctctttttctctacacccaac accgaagctctagttaaccagcacttgtgtgggtctcacctggtagaagccctgtactta gtatgtggggatcgaggcttcttctactaccctaaggtcaaacgggacatggaacaagca cttgtcagtggaccccaggataatgagttggatggaatgcagctccagcctcaggagtat cagaaaatgaagagggggattgtggagcaatgttgccacagcacatgttctctcttccag ctggagagttactgcaactag

DBGET integrated database retrieval system