Xenopus laevis (African clawed frog): 379820 Help Entry 379820            CDS       T01010                                  Symbol eloc.L, tceb1, tceb1.L Name (RefSeq) elongin C L homeolog   KO K03872   elongin-C Organism xla  Xenopus laevis (African clawed frog) Pathway xla04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:xla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     379820 (eloc.L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:xla04121]     379820 (eloc.L)    03400 DNA repair and recombination proteins [BR:xla03400]     379820 (eloc.L) Ubiquitin system [BR:xla04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      379820 (eloc.L)    Cul5 complex      379820 (eloc.L) DNA repair and recombination proteins [BR:xla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      379820 (eloc.L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  379820 NCBI-ProteinID:  NP_001080128 Xenbase:  XB-GENE-6254689 UniProt:  A0A974CM81 Q6PHW7 Structure PDBPDBj LinkDB All DBs Position 6L:complement(110882970..110890070) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggtgaagagaaaacatatggtggctgtgagggtcctgatgccatgtacgtaaaa ctgatttcatctgatggccatgaatttattgttaaaagggaacatgctttgacatcagga acaataaaggccatgttaagtggtccaggacagtttgctgaaaatgaaaccaatgaagtg aatttccgagagattccctcccatgttctatctaaagtctgcatgtattttacctacaag gttcgttacacaaacagctccacagaaatcccagaatttcccattgcgccagagatcgcg ctggaactgctgatggcggcaaacttcctagactgttaa

DBGET integrated database retrieval system