Xenopus laevis (African clawed frog): 380475 Help Entry 380475            CDS       T01010                                  Symbol pfn2.L, pfn2, Profilin2, XProfilin2 Name (RefSeq) profilin 2 L homeolog   KO K05759   profilin Organism xla  Xenopus laevis (African clawed frog) Pathway xla04810   Regulation of actin cytoskeleton xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     380475 (pfn2.L)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     380475 (pfn2.L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     380475 (pfn2.L)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:xla04812]     380475 (pfn2.L)    04147 Exosome [BR:xla04147]     380475 (pfn2.L) Membrane trafficking [BR:xla04131]  Others   Actin-binding proteins    Others     380475 (pfn2.L) Cytoskeleton proteins [BR:xla04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      380475 (pfn2.L) Exosome [BR:xla04147]  Exosomal proteins   Proteins found in most exosomes    380475 (pfn2.L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  380475 NCBI-ProteinID:  NP_001080782 Xenbase:  XB-GENE-6077929 UniProt:  Q7ZWT1 A0A974CY41 LinkDB All DBs Position 5L:126706226..126734272 Genome browser AA seq 140 aa AA seqDB search MSGWQDYVDMLMADGSCQEAAIVGYVDAKYVWATTPGGIFQIITPAEIDVLIGKDREGFF TGGLTVGGKKCSVIRDSLYIENDLTMDIRTKSQGGEPTYNIAVGKAVRVLVFAMGKEGVH GGGLNKKTYAMAKYLRDMGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtccggctggcaggattacgtggatatgctgatggccgatggcagctgccaggaggcc gccattgtcggttacgtggacgccaagtacgtgtgggcgacgactccggggggaatcttt cagattataacgcctgcagaaattgatgtgctcatagggaaggacagagaaggattcttc actggaggcctaactgtgggaggaaagaaatgctctgttataagagacagcctctatatt gagaacgatttaacaatggacatcaggacaaagagtcaaggaggtgaaccaacatacaat attgctgtaggaaaagctgtaagagtcttggtgtttgcaatgggcaaggaaggcgtccac ggcggcggcctgaacaaaaagacatacgcaatggcaaaatacttgagagatatgggattc tag

DBGET integrated database retrieval system