Xenopus laevis (African clawed frog): 399446 Help Entry 399446            CDS       T01010                                  Symbol nras.L, n-ras, nras, nras1 Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism xla  Xenopus laevis (African clawed frog) Pathway xla04010   MAPK signaling pathway xla04012   ErbB signaling pathway xla04068   FoxO signaling pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04150   mTOR signaling pathway xla04210   Apoptosis xla04218   Cellular senescence xla04370   VEGF signaling pathway xla04371   Apelin signaling pathway xla04540   Gap junction xla04625   C-type lectin receptor signaling pathway xla04810   Regulation of actin cytoskeleton xla04910   Insulin signaling pathway xla04912   GnRH signaling pathway xla04916   Melanogenesis Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     399446 (nras.L)    04150 mTOR signaling pathway     399446 (nras.L)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     399446 (nras.L)    04137 Mitophagy - animal     399446 (nras.L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     399446 (nras.L)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     399446 (nras.L)    04031 GTP-binding proteins [BR:xla04031]     399446 (nras.L) Membrane trafficking [BR:xla04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     399446 (nras.L)  Endocytosis   Macropinocytosis    Ras GTPases     399446 (nras.L) Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    399446 (nras.L)   Exosomal proteins of other body fluids (saliva and urine)    399446 (nras.L)   Exosomal proteins of breast cancer cells    399446 (nras.L)   Exosomal proteins of colorectal cancer cells    399446 (nras.L) GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     399446 (nras.L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Motif Other DBs NCBI-GeneID:  399446 NCBI-ProteinID:  NP_001084337 Xenbase:  XB-GENE-6085929 UniProt:  Q91806 A0A974DLR3 LinkDB All DBs Position 2L:55365374..55388572 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINAYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTKQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIHQYRMKKLDSSEDNNQG CIRIPCKLM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataaactggtggtggtgggagcaggaggtgttgggaaaagtgccttaaca atccagcttatacagaaccattttgtagatgagtatgatcctactatcgaggattcctat agaaaacaggtagtgattgatggagagacttgcctgttggatattttagacacggctggt caagaggaatacagtgctatgcgtgaccagtatatgaggaccggggaaggatttctgtgt gtatttgctattaataacagcaagtcttttgctgatattaatgcctacagggaacagata aaacgagtgaaagactcagatgatgtccccatggtgcttgttggaaataaatgcgatttg ccaagcagaaccgtggataccaagcaagcccaagagcttgccagaagctatggaattcct ttcatcgagacctcggcaaagacaagacagggggtagaagatgcattttacaccttggtt agagaaattcatcagtatagaatgaagaaattggacagcagtgaagataacaatcaagga tgtatccgaattccctgcaagcttatgtaa

DBGET integrated database retrieval system