Xenopus laevis (African clawed frog): 443858 Help Entry 443858            CDS       T01010                                  Symbol dpy30.S, dpy30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism xla  Xenopus laevis (African clawed frog) Brite KEGG Orthology (KO) [BR:xla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xla03036]     443858 (dpy30.S) Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      443858 (dpy30.S)     MLL-HCF complex      443858 (dpy30.S)     MLL3/MLL4 complex      443858 (dpy30.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-GeneID:  443858 NCBI-ProteinID:  NP_001085432 Xenbase:  XB-GENE-6251732 UniProt:  Q6GQK3 A0A974CQY9 LinkDB All DBs Position 5S:42399303..42404718 Genome browser AA seq 99 aa AA seqDB search MDTEQSMEGQTQVSENPHSEYGLTENVERIVENEKTSTEKISKQKVDLQGLPTRAYLDQT VVPILLQGLAVLAKERPPNPIEFLAAYLLKNKTQFEERS NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggatacagagcaaagcatggagggacagacacaggtttccgaaaaccctcattctgaa tatgggctcacagagaatgttgagagaatagtcgaaaatgagaagaccagtactgaaaaa atatccaaacagaaggttgatctgcagggtttgcccacaagagcgtatcttgaccaaaca gtagttcctatacttttacaaggccttgcagtgcttgcaaaggaaagaccaccaaaccca atagaattccttgcagcttatctcttaaagaacaagacacagtttgaggaacgaagctag

DBGET integrated database retrieval system