Xenopus laevis (African clawed frog): 447745 Help Entry 447745            CDS       T01010                                  Name (RefSeq) MGC83272 protein   KO K05754   actin related protein 2/3 complex, subunit 5 Organism xla  Xenopus laevis (African clawed frog) Pathway xla04144   Endocytosis xla04530   Tight junction xla04810   Regulation of actin cytoskeleton xla05100   Bacterial invasion of epithelial cells xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     447745   09144 Cellular community - eukaryotes    04530 Tight junction     447745   09142 Cell motility    04810 Regulation of actin cytoskeleton     447745  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     447745    05100 Bacterial invasion of epithelial cells     447745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     447745   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:xla04812]     447745 Membrane trafficking [BR:xla04131]  Others   Actin-binding proteins    Arp2/3 complex     447745 Cytoskeleton proteins [BR:xla04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Arp2/3 complex      447745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P16-Arc Utp12 Phage_antiter_Q Motif Other DBs NCBI-GeneID:  447745 NCBI-ProteinID:  NP_001087884 Xenbase:  XB-GENE-17330993 UniProt:  Q641B9 A0ABD8DWL1 LinkDB All DBs Position 4S:79503933..79510684 Genome browser AA seq 150 aa AA seqDB search MAKNTVSARFRKVDVDEYDENKFVDEEEAGEGQQGPDEGEVDSAIRGGNMMGALQAVLKN PPINTKNQSAKDQAEHLVLKVLISFKANEIEKAVQSLDKNSMDLLMKYIYKGFESPSDNS SAVLLQWHEKALAVAGVGSIVRVLTARKTV NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaatacggtgtccgcccgcttccggaaagtagatgtagatgaatatgatgag aacaagttcgtggacgaagaggaggccggagaagggcagcaaggaccagacgagggggag gttgatagcgcgattcggggaggaaacatgatgggagctctgcaagctgttctgaagaat ccacctattaataccaagaatcagtctgccaaggatcaagctgagcacctggtgctgaaa gttcttatctcctttaaagcaaatgaaatagaaaaggctgttcagtctttagacaaaaat agcatggacctcttaatgaaatacatctacaagggctttgagagtccgtccgacaacagc agtgctgtcctgttgcagtggcatgagaaggctctggcagtggcaggtgtcggctccata gtcagagttctgactgcaagaaagacagtttga

DBGET integrated database retrieval system