Xenopus laevis (African clawed frog): 779066 Help Entry 779066            CDS       T01010                                  Symbol arf4.L, arf2, arf4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism xla  Xenopus laevis (African clawed frog) Pathway xla04144   Endocytosis Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     779066 (arf4.L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     779066 (arf4.L)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     779066 (arf4.L)    04031 GTP-binding proteins [BR:xla04031]     779066 (arf4.L) Membrane trafficking [BR:xla04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     779066 (arf4.L) Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    779066 (arf4.L)   Exosomal proteins of other body fluids (saliva and urine)    779066 (arf4.L)   Exosomal proteins of colorectal cancer cells    779066 (arf4.L) GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     779066 (arf4.L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M Csa3_N RXYLT1_N CRISPR_Cas2 AAA_18 cobW Motif Other DBs NCBI-GeneID:  779066 NCBI-ProteinID:  NP_001090186 Xenbase:  XB-GENE-865045 UniProt:  P51644 A0AAF6DMH0 A0AA97PZD3 LinkDB All DBs Position 4L:complement(149617767..149631533) Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAV LLVFANKQDLPNAMAISEMTDKLTLQTLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctcgctcttctcccggctcttcggcaagaaacagatgcggatt ctcatggttggtttggatgccgccggcaagacaacgattctgtacaaattaaagttaggg gaaattgtgactaccattcccaccattggttttaatgtggaaaccgttgaatacaaaaat atctgctttactgtgtgggacgtgggtggccaagataaaatccgccccctatggaggcat tatttccagaatacacagggcctcatatttgtagtagatagcaacgacagagagagaatt caggaagccgcagaggaattacagaaaatgcttcaagaagatgagcttcgggacgcagtg ctccttgtgttcgccaacaaacaagatctgcccaatgcaatggccattagtgagatgaca gacaagctgacacttcagactctccgcaacaggacttggtacgttcaagcaacatgcgct actcagggcaccggcctgtatgaaggacttgattggctttcaaacgaactctccaaacgc taa

DBGET integrated database retrieval system