Xanthomonas medicagonis: AB3X07_04895 Help Entry AB3X07_04895      CDS       T10867                                  Name (GenBank) ACT domain-containing protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xmd  Xanthomonas medicagonis Pathway xmd00290   Valine, leucine and isoleucine biosynthesis xmd00650   Butanoate metabolism xmd00660   C5-Branched dibasic acid metabolism xmd00770   Pantothenate and CoA biosynthesis xmd01100   Metabolic pathways xmd01110   Biosynthesis of secondary metabolites xmd01210   2-Oxocarboxylic acid metabolism xmd01230   Biosynthesis of amino acids Module xmd_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xmd_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xmd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     AB3X07_04895    00660 C5-Branched dibasic acid metabolism     AB3X07_04895   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     AB3X07_04895   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     AB3X07_04895 Enzymes [BR:xmd01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      AB3X07_04895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Sharpin_PH Motif Other DBs NCBI-ProteinID:  XEB10508 LinkDB All DBs Position complement(1142719..1142967) Genome browser AA seq 82 aa AA seqDB search MRYQLDLVLKPIDGALLRAIGMAERRGFAPISISGAPVAEDAGRWHLQLVVDGNRPGETL RLQMEKVYDCESVRVTALDGVA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccagcttgacctggtgctgaaaccgatcgacggcgccctgctgcgcgcgatc ggcatggccgaacgccgcggcttcgcgccgatctcgatcagcggcgcgccggtggccgag gacgccggccgctggcatctgcaactggtggtggacggcaaccgccccggcgagaccctg cgcctgcagatggagaaggtctacgactgcgaatcggtgcgcgtgaccgcgctggatggc gtagcgtga

DBGET integrated database retrieval system