Xenorhabdus nematophila ATCC 19061: XNC1_0216 Help Entry XNC1_0216         CDS       T01274                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism xne  Xenorhabdus nematophila ATCC 19061 Brite KEGG Orthology (KO) [BR:xne00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xne03036]     XNC1_0216 Chromosome and associated proteins [BR:xne03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     XNC1_0216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Leu_zip DUF7491 CtIP_N Seryl_tRNA_N Nuf2_DHR10-like XRCC4_CC CC149 CC2-LZ PspA_IM30 YabA GAS TMF_TATA_bd ERM_helical USHBP1_PDZ-bd Sec10_N WipA_N DUF3450 UPF0242 ATG14 Cnn_1N Sec20 Herpes_UL6 Spc7 DUF2968 APG6_N DivIC FlaC_arch dCache_2 DUF4763 Motif Other DBs NCBI-ProteinID:  CBJ88304 UniProt:  D3VH19 LinkDB All DBs Position 190130..190372 Genome browser AA seq 80 aa AA seqDB search MSFEVFEKLESKVQQAIDTITLLQMEIEELKEQNAVLSQDVQNAADNRDALVRENEQLKQ EQSAWQERLRTLLGKMEDVQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtttttgaaaagctagaatcgaaagttcagcaagcgattgataccatc actttgctgcaaatggaaattgaagaattaaaagaacagaacgcagtgttatctcaggat gtccaaaatgcggcagacaaccgtgatgcactggtacgtgaaaatgagcagctcaaacaa gaacaatcagcatggcaagagcgcttgcgtactctgttgggtaaaatggaagatgtgcag taa

DBGET integrated database retrieval system