KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2297
Entry
XOO2297           CDS       T00235                                 
Symbol
msbA
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    XOO2297 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xoo02000]
    XOO2297 (msbA)
Enzymes [BR:xoo01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     XOO2297 (msbA)
Transporters [BR:xoo02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    XOO2297 (msbA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 nSTAND1 AAA_30 AAA_29 AAA_21 DUF3584 RsgA_GTPase MMR_HSR1 AAA_23 AAA_15 AAA_24
Other DBs
NCBI-ProteinID: AAW75551
UniProt: Q5H0H0
LinkDB
Position
complement(2432657..2434426)
AA seq 589 aa
MTNSTDRPVSVSSWRTYRRLVAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF
IYKNAEVSRWLPVQIILLFVVRGIAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF
DSEPVPSMLIRLGSDSDQVAQAAVDAIKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP
VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQTEMERYGALADR
NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP
GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGAVALTRAKGLIEFRDVTARYPGQVN
PALADVSFIAQPGTVTAIVGRSGSGKSSLIKLIPRFYDAEAGQILLDGQPVQAYALADLR
RQIALVGQQVMLFDGSIAENVAFGEMRSADASQLERAILGANAMEFVAQLPEGLQSHVGA
KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA
HRLSTIEHADQVLVMDQGRIVERGTHHELLAQGGLYSHLHGMQFRERQA
NT seq 1770 nt   +upstreamnt  +downstreamnt
gtgaccaactccaccgaccgcccggtgtcagtttcatcctggcgcacgtaccgtcgcctg
gtggcgttcgccaagccgtatcgtttgctgctggtcgcggcgctgatcgcggccttgatc
gaagcggccggcaccaccggttttctggcattgatgaagccgatcaccgacgaaaccttc
atctacaagaatgccgaagtcagtcgctggctgccggtgcagatcatcttgctgttcgtg
gtgcgtggtattgccggctacatcaccgatatggcgatgggtaaatccgcacgcagcatt
gcgcgcgatctgcgcatcaaggtcatggcgaaatatctgcgtctgcccggatcgcgcttc
gattcggagccagtgccgtcgatgctgatccgtttgggttctgattcggaccaggttgcg
caagccgcggtggatgcgatcaaggtgatgatccagcaatcgctgcaagtcatcggcgcg
ctggcgctgatgttgtggcatagctggcaggtgacgctgaccattctggtgctcgccccg
gtgctggcttgggtgatggacaaggtggcgcggcgctaccggcgtatcagccacagcatc
caggaaagcggcgcgcacttgctgcaggccgcagaccagaccttgtccagccatcaggag
gtcaagatctacggcgcgcagcagaccgagatggagcgctatggcgcgctcgccgatcgc
aatctgcgcctggcgatgaaggtcgaatccacgcgcggcatttccaccgcgacggtgcag
atgattggtgcgatcggcctgtcggcgttgctgttcgtggctggtgcgcaggcattggcc
gggcgcctgacggccggtgatttcgtcgtgctgatgacttcgatgctgacgatcattccg
ggcctcaagcagctcaccaatgtgcagaacatggtgcagcgtggcctggcatcggccgag
cgcttgttctcggtgctcgatagcccggacgagccggatcaaggcgccgtagcgctgacg
cgtgccaagggcttgatcgaattccgcgatgtcactgcgcgctacccaggtcaggtcaat
ccggcgttggccgatgtcagcttcatcgcgcagccgggcacggtgaccgcgatcgtcggc
cgctcgggcagcggcaaatccagcctgatcaagttgattccacgcttctacgacgccgag
gccgggcagattctgctcgacggacaaccggtgcaggcgtatgcattggcggatctgcgc
cggcagattgcgctcgtcggtcagcaggtcatgctgttcgacggcagcatcgccgaaaac
gtggcgttcggcgaaatgcgcagcgccgacgccagccagctggagcgtgcgattctgggt
gccaatgcgatggaatttgtcgcgcaactgcccgaaggcctgcagtcgcatgtcggtgcc
aagggggggcgtctgtccggcggccagcgccagcgtctggcgatcgcacgcgccatgctc
aaggacgcgccgatcctgatcctggacgaagcgactgcagcgctggacaacgaatccgag
cgcttggtgcaagacgccctgcacaagctgatgccggaccgcaccacgctggtgatcgcg
catcgcctgtccaccatcgaacatgccgatcaggtgctggtgatggaccagggccggatc
gtcgagcgtggcacgcatcacgaattgctggcgcagggcggcttgtattcgcacctgcac
ggcatgcagttccgcgaacgccaggcatga

DBGET integrated database retrieval system