Xanthomonas oryzae pv. oryzae PXO99A: PXO_02380 Help Entry PXO_02380         CDS       T00763                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism xop  Xanthomonas oryzae pv. oryzae PXO99A Brite KEGG Orthology (KO) [BR:xop00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xop03036]     PXO_02380 Chromosome and associated proteins [BR:xop03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PXO_02380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Taxilin Herpes_BLRF2 SKA2 FAZ1_C YabA bZIP_1 APG6_N Motif Other DBs NCBI-ProteinID:  ACD60671 UniProt:  A0A0K0GNN5 LinkDB All DBs Position 4227345..4227614 Genome browser AA seq 89 aa AA seqDB search MRARLTTPRARAYRERMDNAAALAQIRALAARVEALVERTQRLTDENRSLRHQQEQLIGE RSQLLTKNEQARSRVEAMIAHLKSLEQHT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgcgcgcgcgcttgaccaccccgcgcgcgcgcgcctatcgtgagcgcatggacaacgct gccgccctcgctcagatccgcgcacttgccgcccgcgtggaggccttggtggagcgtacc caacggctgaccgacgaaaaccgcagcctgcgtcaccaacaggaacagctcatcggcgag cgctcgcaactgttgaccaagaacgagcaggcgcgctcgcgtgtggaagcgatgatcgcc cacttgaagtcactggagcagcacacgtga

DBGET integrated database retrieval system