Xanthomonas oryzae pv. oryzae PXO99A: PXO_03840 Help Entry PXO_03840         CDS       T00763                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism xop  Xanthomonas oryzae pv. oryzae PXO99A Pathway xop03060   Protein export xop03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:xop00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PXO_03840  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     PXO_03840  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xop02044]     PXO_03840 Secretion system [BR:xop02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    PXO_03840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Conotoxin Motif Other DBs NCBI-ProteinID:  ACD57034 UniProt:  B2SIH3 LinkDB All DBs Position 395995..396222 Genome browser AA seq 75 aa AA seqDB search MGGFSIWHWLIVLVIVLLVFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGKLGDDSRTA EQAREAQAERDRDAR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggcggtttcagcatttggcactggctgatcgtgctggtgatcgtgttgctggtgttc ggtaccaaacggcttaccagcggtgccaaggatctcggcagcgcggtcaaggaattcaag aaaggcatgcacgacgacgacaagccggccggcaagctcggcgacgactcccgcactgcc gagcaggcgcgtgaggcgcaggccgaacgcgaccgcgacgcgcgctga

DBGET integrated database retrieval system