Xanthomonas oryzae pv. oryzae PXO86: AZ54_04750 Help Entry AZ54_04750        CDS       T03765                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xoy  Xanthomonas oryzae pv. oryzae PXO86 Brite KEGG Orthology (KO) [BR:xoy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xoy03036]     AZ54_04750 Chromosome and associated proteins [BR:xoy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AZ54_04750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF7342 CLLAC Motif Other DBs NCBI-ProteinID:  AJQ82020 LinkDB All DBs Position 975238..975501 Genome browser AA seq 87 aa AA seqDB search MSRLLLIVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHTRDELNIEFGRLQLEQATWAE SNRVDQVARARIGMKFPETNDIVVIRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcctgttgctcatcgtgctgcttgcctgcagcatcgcgtcggcgatcggtgtc gtgtacatgcgccacatgcatcgcaagctgttcgtgcagttgtccaagctcgaacacacg cgcgacgagttgaatatcgaattcggccggctgcagctggagcaggccacgtgggcggaa agcaatcgggtcgatcaagtcgcgcgtgcgcgtatcgggatgaagttcccggagaccaac gacatcgtggtgatacgcccatga

DBGET integrated database retrieval system