Xanthomonas oryzae pv. oryzae PXO86: AZ54_10840 Help Entry AZ54_10840        CDS       T03765                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism xoy  Xanthomonas oryzae pv. oryzae PXO86 Pathway xoy00190   Oxidative phosphorylation xoy01100   Metabolic pathways xoy02020   Two-component system Module xoy_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:xoy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AZ54_10840  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AZ54_10840 Enzymes [BR:xoy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AZ54_10840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AJQ83040 LinkDB All DBs Position complement(2214884..2214994) Genome browser AA seq 36 aa AA seqDB search MWYFAWILGTGLAASAAVLNGMWFEAREPERGVPPQ NT seq 111 nt NT seq  +upstreamnt  +downstreamnt gtgtggtatttcgcatggatcctgggcaccggcctggcggcatcggctgccgtgctcaac ggcatgtggttcgaagcacgcgagcccgagcgtggcgtaccgcctcagtaa

DBGET integrated database retrieval system