Xanthomonas perforans: BJD13_14940 Help Entry BJD13_14940       CDS       T04778                                  Name (GenBank) hypothetical protein   KO K18375   type III secretion hrp pilus HrpE Organism xpe  Xanthomonas perforans Module xpe_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xpe00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xpe02044]     BJD13_14940 Secretion system [BR:xpe02044]  Type III secretion system   Type III secretion related proteins    BJD13_14940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  APP00211 LinkDB All DBs Position 2952365..2952523 Genome browser AA seq 52 aa AA seqDB search MDSLLGDMSASDDAQKSMNNKITMLKNDLDFNVALNKFIGKAGDNAKQLVGQ NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggattcgctactcggcgacatgtcagcctcggacgacgctcagaagtccatgaacaac aagatcacgatgctcaaaaacgatctggacttcaacgtggcactcaacaagttcatcggc aaggcgggcgacaacgctaagcagctcgttggccagtaa

DBGET integrated database retrieval system