Xanthomonas perforans: BJD13_18550 Help Entry BJD13_18550       CDS       T04778                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xpe  Xanthomonas perforans Pathway xpe01100   Metabolic pathways xpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xpe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJD13_18550    00074 Mycolic acid biosynthesis     BJD13_18550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJD13_18550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APP00812 UniProt:  A0A0G9BRJ7 LinkDB All DBs Position 3781295..3781564 Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVQANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagtctgaac ctggaagacgtccaacccgccgacatcgatccggaggcgccgctgttcaataccgggctg gggctggactcgatcgacgccctggaactggcgctggcgatcagcaagcgctacggcttc cagctgcgctctgacaacgacgaaaaccgtcgcatcttcgcgtcgctgcgcgcactgtcg gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system