Xanthomonas perforans: BJD13_21885 Help Entry BJD13_21885       CDS       T04778                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xpe  Xanthomonas perforans Pathway xpe00290   Valine, leucine and isoleucine biosynthesis xpe00650   Butanoate metabolism xpe00660   C5-Branched dibasic acid metabolism xpe00770   Pantothenate and CoA biosynthesis xpe01100   Metabolic pathways xpe01110   Biosynthesis of secondary metabolites xpe01210   2-Oxocarboxylic acid metabolism xpe01230   Biosynthesis of amino acids Module xpe_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xpe_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xpe00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BJD13_21885    00660 C5-Branched dibasic acid metabolism     BJD13_21885   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BJD13_21885   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BJD13_21885 Enzymes [BR:xpe01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BJD13_21885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  APP01412 UniProt:  A0A0G9DCC9 LinkDB All DBs Position complement(4488887..4489144) Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLLLDVDSNRPPETL RLQLEKVYDCESVVITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgaagccggcagaaggcgcgttggtgcgggtgatc ggcatgaccgaacgccgtggcttccgcccatgtgcgatccagggcgcagcagcgccggac gatgccgggcgctggcatctgctgctggacgtggacagcaaccgtccgccggaaacgctg cgcctgcagctggaaaaggtctacgactgcgaatcggtggtaatcaccgcactggaatcg gtcgaggctgcggcatga

DBGET integrated database retrieval system