Xanthomonas phaseoli: XppCFBP6546_00835
Help
Entry
XppCFBP6546_00835 CDS
T05156
Symbol
petA, XppCFBP6546P_00835
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
xph
Xanthomonas phaseoli
Pathway
xph00190
Oxidative phosphorylation
xph01100
Metabolic pathways
xph02020
Two-component system
xph04148
Efferocytosis
Module
xph_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
xph00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
XppCFBP6546_00835 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
XppCFBP6546_00835 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
XppCFBP6546_00835 (petA)
Enzymes [BR:
xph01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
XppCFBP6546_00835 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
Motif
Other DBs
NCBI-ProteinID:
ATS28605
LinkDB
All DBs
Position
complement(2457730..2458374)
Genome browser
AA seq
214 aa
AA seq
DB search
MANDGVNAPADIGRRRFLTATTAVVGAVGAGFVAVPFVKSWNPSARAKLAGAPVTADISA
LQEGQRMVLEWRGQPIWIVKRSKAMLDALPSLDDRLKDPKSENKDQQPEYVLKNPEYRSI
KSDISVLVGLCTHLGCSPEMVAEIRPEPYDPQWKGGYFCPCHKSRFDMSGRVFDGVPAPI
NLLVPPHHYVDDNTLVIGVDPDDAGASTKSTGAA
NT seq
645 nt
NT seq
+upstream
nt +downstream
nt
atggccaacgatggggttaacgcacctgctgatatcgggcgtcgtcggtttttaaccgcg
acaacggctgtggtcggtgcggtcggagcaggattcgttgcagttccgttcgtgaagtcg
tggaatcccagtgcgcgcgccaagttggccggtgcaccggtcaccgccgacatcagcgcc
ttgcaggaaggccagcgcatggtccttgaatggcgcggtcagcccatctggatcgtcaag
cgctccaaggccatgctcgacgcactcccgtcgctggacgaccggctcaaggaccccaag
tccgagaacaaggatcagcagcctgagtacgtgctgaaaaacccggaataccgctcgatc
aagtccgacatttcggtactggtcgggctatgtacgcatctgggctgctcgccggagatg
gtcgccgaaatccgccccgagccttacgacccgcagtggaagggcggttatttctgccct
tgccacaagtcgcgcttcgacatgtctggccgcgtcttcgacggtgtgccggcgccgatc
aatctgctggtgcccccacaccactacgtggacgacaacaccttggtgatcggcgtcgat
cctgacgatgccggtgcgtcgaccaaaagcacgggggctgcctga
DBGET
integrated database retrieval system