Xanthomonas phaseoli: XppCFBP6546_05955 Help Entry XppCFBP6546_05955 CDS       T05156                                  Symbol acpP, XppCFBP6546P_05955 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xph  Xanthomonas phaseoli Pathway xph01100   Metabolic pathways xph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XppCFBP6546_05955 (acpP)    00074 Mycolic acid biosynthesis     XppCFBP6546_05955 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XppCFBP6546_05955 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ATS29439 LinkDB All DBs Position 1295621..1295860 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaagcc gagaagatcacctcggtgcagcaggcgatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system