Xanthomonas phaseoli: XppCFBP6546_16925 Help Entry XppCFBP6546_16925 CDS       T05156                                  Symbol XppCFBP6546P_16925 Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xph  Xanthomonas phaseoli Pathway xph00290   Valine, leucine and isoleucine biosynthesis xph00650   Butanoate metabolism xph00660   C5-Branched dibasic acid metabolism xph00770   Pantothenate and CoA biosynthesis xph01100   Metabolic pathways xph01110   Biosynthesis of secondary metabolites xph01210   2-Oxocarboxylic acid metabolism xph01230   Biosynthesis of amino acids Module xph_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xph_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xph00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     XppCFBP6546_16925 (XppCFBP6546P_16925)    00660 C5-Branched dibasic acid metabolism     XppCFBP6546_16925 (XppCFBP6546P_16925)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     XppCFBP6546_16925 (XppCFBP6546P_16925)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     XppCFBP6546_16925 (XppCFBP6546P_16925) Enzymes [BR:xph01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      XppCFBP6546_16925 (XppCFBP6546P_16925) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ATS31173 LinkDB All DBs Position 3925488..3925745 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLLLDVDSNRPPETL RLQLEKVYDCESVVITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgaagccggcagaaggcgcgttggtgcgggtgatc ggcatgaccgaacgccgcggcttccgcccatgcgcgatccagggcgccgcagcgccagac gatgccgggcgctggcatctgctgctggatgtggacagcaaccgtccgccggaaacgctg cgcctgcagctggaaaaggtctacgactgcgaatcggtggtgatcaccgcactggaatcg gtcgaggcggcggcatga

DBGET integrated database retrieval system