Xenorhabdus poinarii: XPG1_1319 Help Entry XPG1_1319         CDS       T03805                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism xpo  Xenorhabdus poinarii Pathway xpo00998   Biosynthesis of various antibiotics xpo01100   Metabolic pathways xpo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xpo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XPG1_1319 (acpP)    00074 Mycolic acid biosynthesis     XPG1_1319 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XPG1_1319 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF5798 Motif Other DBs NCBI-ProteinID:  CDG20974 UniProt:  A0A068R1P7 LinkDB All DBs Position 1304894..1305130 Genome browser AA seq 78 aa AA seqDB search MSTIDERVKKIIVEQLGVKEEEVVNTASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVENAGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgacgaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagag gaagaagttgtgaacacagcttcatttgttgatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgagatcccagacgaagaagct gaaaaaatcactacagttcaggctgctattgactacgttgaaaacgcaggtaaataa

DBGET integrated database retrieval system