Xanthomonas prunicola: MUG10_14670 Help Entry MUG10_14670       CDS       T08368                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xpr  Xanthomonas prunicola Pathway xpr00290   Valine, leucine and isoleucine biosynthesis xpr00650   Butanoate metabolism xpr00660   C5-Branched dibasic acid metabolism xpr00770   Pantothenate and CoA biosynthesis xpr01100   Metabolic pathways xpr01110   Biosynthesis of secondary metabolites xpr01210   2-Oxocarboxylic acid metabolism xpr01230   Biosynthesis of amino acids Module xpr_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xpr_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xpr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     MUG10_14670    00660 C5-Branched dibasic acid metabolism     MUG10_14670   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     MUG10_14670   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     MUG10_14670 Enzymes [BR:xpr01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      MUG10_14670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  USI99317 LinkDB All DBs Position complement(3278665..3278922) Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLTPAEGTLVRVIGMTERRGFRPCAIQGAAVPDDAGRWHLQLDVDSNRPPETL RLQLEKVYDCESVMITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgacgccggcagaaggcacgctggtgcgggtgatc ggcatgaccgagcgccgcggcttccgcccatgcgcgatccagggtgcggcagtcccagac gatgccggccgctggcatctgcagcttgatgtggacagcaaccgtccaccggaaacgctg cgcctgcagctggaaaaggtctacgactgcgaatcggtgatgatcaccgcgctggaatcg gtcgaggccgcggcatga

DBGET integrated database retrieval system