Xanthomonas sacchari: SB85_07515 Help Entry SB85_07515        CDS       T03566                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xsa  Xanthomonas sacchari Pathway xsa01100   Metabolic pathways xsa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xsa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SB85_07515    00074 Mycolic acid biosynthesis     SB85_07515   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SB85_07515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  AJC45647 UniProt:  A0A0A8DW95 LinkDB All DBs Position complement(1837993..1838232) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacagctcggcgtcaaggaa gaagaagtcaccaacaacgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggccctggaagaagagttcgagtgcgagatcccggacgaagaagcc gagaagatcacctcggtgcagcaggccatcgactacgtcaaggcgcacgtcaagagctga

DBGET integrated database retrieval system