Xanthomonas sontii: RAB70_15400 Help Entry RAB70_15400       CDS       T10538                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xso  Xanthomonas sontii Pathway xso01100   Metabolic pathways xso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAB70_15400    00074 Mycolic acid biosynthesis     RAB70_15400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAB70_15400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF4108 Motif Other DBs NCBI-ProteinID:  XCI83627 LinkDB All DBs Position 3664581..3664856 Genome browser AA seq 91 aa AA seqDB search MTPSIESQIHSIVAKHGEIDPARLTPDAKLQDLGVDSLEAIEILFDIEEHFDITFPQRDP NLDDGSLGKLVQAVEDALAAKAAAGAAQPAH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccccgtccatcgagtcgcaaatccacagcatcgtcgccaagcatggcgagatcgac ccggcgcgcctgacccccgatgccaagctgcaggacctgggcgtggattcgctcgaggcc atcgaaatcctgttcgacatcgaagaacacttcgacatcaccttcccgcagcgcgacccg aacctggacgacggttcgctcggcaagctggtgcaggcggtcgaggacgcgctggcggcc aaggcggcggccggcgcggcgcaaccggcgcactga

DBGET integrated database retrieval system