Xanthomonas sontii: RAB70_16750
Help
Entry
RAB70_16750 CDS
T10538
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
xso Xanthomonas sontii
Pathway
xso00770
Pantothenate and CoA biosynthesis
xso01100
Metabolic pathways
xso01240
Biosynthesis of cofactors
Module
xso_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
xso00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
RAB70_16750 (coaD)
Enzymes [BR:
xso01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
RAB70_16750 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Motif
Other DBs
NCBI-ProteinID:
XCI83878
LinkDB
All DBs
Position
complement(3977533..3978039)
Genome browser
AA seq
168 aa
AA seq
DB search
MTVAHSRIAVYPGTFDPITNGHIDLVNRAAPLFEQVIVGVAQSPSKGPTLPLDLRVSLAR
EALAGHRNVEVLGFDTLLAHFVRSVGGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL
FLTPAEQHSFISSSLVREIARLGGDVSGFVPPSVVQALVQARQAAAQR
NT seq
507 nt
NT seq
+upstream
nt +downstream
nt
atgaccgtggcccatagccgcatcgccgtctatcccggcaccttcgatccgatcaccaac
ggccatatcgatctggtcaaccgtgccgcaccgctgttcgagcaggtgatcgtgggcgtg
gcgcagagcccctccaaggggccgaccctgccgctggacctgcgcgtgtcgctggcccgc
gaggcgctggccgggcaccgcaacgtggaagtgctgggcttcgacacgctgctggcgcat
ttcgtgcgctcggtcggcggcggcgtgctgctgcgcggcctgcgcgcggtgtcggacttc
gaatacgagttccagatggcgagcatgaacaggcatctgatcccggaggtggagaccctg
ttcctcaccccggccgagcaacacagcttcatttcgtcctcgttggtgcgcgagatcgcg
cgcctgggcggggacgtctccggcttcgtgccgccgtcggtggtgcaggcgctggtccag
gcccgccaggccgccgcgcagcgctga
DBGET
integrated database retrieval system