Xanthomonas theicola: G4Q83_05055 Help Entry G4Q83_05055       CDS       T06965                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xth  Xanthomonas theicola Pathway xth01100   Metabolic pathways xth01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xth00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G4Q83_05055    00074 Mycolic acid biosynthesis     G4Q83_05055   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G4Q83_05055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNH24247 LinkDB All DBs Position complement(1126932..1127207) Genome browser AA seq 91 aa AA seqDB search MTPSIETQIHSIVAKHGEIDPAGLTPDTKLQDLGLDSLEAIEILFDIEEHFDITFPQRDP NLDDGSLGKLTEAVQQALAAKAAAAPLAAAH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccccgtctatcgagacacagatccacagcatcgtcgccaagcacggcgagatcgat cccgccggcctgaccccggacaccaaactgcaggacctgggcctggattcgctcgaggcg atcgaaatcctgttcgacatcgaggagcacttcgacatcaccttcccgcagcgcgatccg aacctggacgacggctcgctgggcaagctgaccgaagcggtgcaacaggcgctggccgcc aaggccgccgccgctccgctggccgcggcgcactga

DBGET integrated database retrieval system