Xanthomonas theicola: G4Q83_11030 Help Entry G4Q83_11030       CDS       T06965                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xth  Xanthomonas theicola Pathway xth01100   Metabolic pathways xth01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xth00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G4Q83_11030 (acpP)    00074 Mycolic acid biosynthesis     G4Q83_11030 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G4Q83_11030 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QNH25160 LinkDB All DBs Position complement(2370574..2370813) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaagaagtcaccaacagcgcatcgttcgtcgatgacctcggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagattccggacgaagaagcc gagaagatcacctcggtgcagcaggccatcgactacgtcaaggcgcacgtcaagagctga

DBGET integrated database retrieval system