Xanthomonas theicola: G4Q83_12615
Help
Entry
G4Q83_12615 CDS
T06965
Name
(GenBank) YfhL family 4Fe-4S dicluster ferredoxin
Organism
xth
Xanthomonas theicola
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Fer4
Fer4_7
Fer4_10
GF_recep_IV
Fer4_9
Fer4_6
Fer4_2
Fer4_21
Fer4_4
Fer4_16
Fer4_17
Fer4_3
Motif
Other DBs
NCBI-ProteinID:
QNH25414
LinkDB
All DBs
Position
complement(2681287..2681571)
Genome browser
AA seq
94 aa
AA seq
DB search
MSLKINELCVNCDVCEPACPNQAIAMGETIYVIDPARCTECVGHFDEPQCVVVCPVECID
PDPAIPESHDQLLAKLLRLQRDHPQSYPQEPAAV
NT seq
285 nt
NT seq
+upstream
nt +downstream
nt
atgtccctcaagatcaacgagctctgcgtcaactgcgacgtctgcgagccggcctgcccg
aaccaggccatcgcgatgggcgagacgatctacgtgatcgatccggcccgctgcaccgaa
tgcgtcggccatttcgacgagccgcaatgcgtggtggtgtgcccggtcgagtgcatcgac
ccggatccggcgatcccggaaagccacgaccagttgctggccaagctgttgcgactgcag
cgcgatcatccccagtcgtacccacaggagcccgccgccgtatga
DBGET
integrated database retrieval system