Xanthomonas theicola: G4Q83_16760 Help Entry G4Q83_16760       CDS       T06965                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xth  Xanthomonas theicola Pathway xth00290   Valine, leucine and isoleucine biosynthesis xth00650   Butanoate metabolism xth00660   C5-Branched dibasic acid metabolism xth00770   Pantothenate and CoA biosynthesis xth01100   Metabolic pathways xth01110   Biosynthesis of secondary metabolites xth01210   2-Oxocarboxylic acid metabolism xth01230   Biosynthesis of amino acids Module xth_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xth_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     G4Q83_16760    00660 C5-Branched dibasic acid metabolism     G4Q83_16760   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     G4Q83_16760   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     G4Q83_16760 Enzymes [BR:xth01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      G4Q83_16760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF7393 Motif Other DBs NCBI-ProteinID:  QNH26070 LinkDB All DBs Position complement(3586298..3586546) Genome browser AA seq 82 aa AA seqDB search MRYQLDLVLKPAEGALLRAIGMAERRGFAPLSITGAPVADDAGRWHLQMVVDGSRPGESL RLQMEKVYDCESVRVTALDGTP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgataccagcttgacctggtgctgaagccggccgaaggcgccttgctgcgcgcgatc ggcatggccgagcgccgcggcttcgcgccgctgtcgatcaccggcgcgccggtggccgac gacgccggccgctggcacctgcagatggtggtcgacggcagccgccccggcgagagcctg cgcctgcagatggagaaggtgtacgactgcgagtcggtgcgggtcaccgcgctggatggg acgccatga

DBGET integrated database retrieval system