KEGG   Xanthomonas translucens pv. undulosa: FD63_10415
Entry
FD63_10415        CDS       T03961                                 
Name
(GenBank) flagellar protein FliI
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
xtn  Xanthomonas translucens pv. undulosa
Pathway
xtn02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:xtn00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    FD63_10415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xtn02044]
    FD63_10415
   02035 Bacterial motility proteins [BR:xtn02035]
    FD63_10415
Enzymes [BR:xtn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     FD63_10415
Secretion system [BR:xtn02044]
 Type III secretion system
  Flagellar export apparatus
   FD63_10415
Bacterial motility proteins [BR:xtn02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    FD63_10415
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ABC_tran
Other DBs
NCBI-ProteinID: AKK67861
LinkDB
Position
2417997..2419373
AA seq 458 aa
MSALSGTHPADWLDARNLRLASRLGQLGLDAAAGRGLIREGILRRAVGLTLEAVGCEAPM
GATCRVEVDGGWVDAEVVGFSGERTSLMPSAETHGLLPNARVVPVRRRGGVEVGEGLLGR
VIDSDGVPLDGKGPIRAEGSVGMAGISINPLAREPITMPLDVGVRAINALLPIGRGQRVG
LFAGSGVGKSTLLGMMTRYTAADVIVVGLIGERGREVRDFVETTLGEEGLRRAVVVAAPA
DRPPLARLHGAYRATAIAEWFRDQGLNVLLLMDSLTRFAQAQREIGLSVGEPPTTRGYPP
SVFAKLPALVERAGNGAKGRGSITAFYTVLTEGDDPQDPIADAARAILDGHILLSRRVAD
SGLYPAIDVESSVSRVVQDIADEPWRLRIRALKRLVSAYSANRDLITIGAYQRGNDAAVD
EALERWPEIMEFLGQDVAKAADLPHSQAALKRLVEREN
NT seq 1377 nt   +upstreamnt  +downstreamnt
gtgagcgcgctgtccggcacccatccggcagactggctggacgcgcgtaacctgcgcctg
gcctcgcgcctgggccagctcggcctcgacgccgccgccggccgcggcctgatccgcgaa
ggcatcctgcgccgcgcggtcgggctgaccctggaagcggtcggctgcgaggcgccgatg
ggcgccacctgcagggtcgaggtcgacggcggctgggtcgatgccgaggtggtcgggttc
tccggcgagcgtacctcgctgatgcccagcgccgaaacccacggcctgctgcccaacgcg
cgggtggtgccggtgcgccgccgcggcggcgtggaagtgggcgaaggcctgctcggccgg
gtcatcgattcggacggcgtgccgctggacggcaagggcccgatccgcgccgaaggctcg
gtcggcatggccggcatctcgatcaacccactggcgcgcgaaccgatcaccatgccgctg
gacgtgggcgtgcgcgcgatcaacgcgctgctgccgatcggccgcggccagcgcgtgggc
ctgttcgccggctccggcgtcggcaaatccaccctgctcgggatgatgacccgctacacc
gcggccgatgtgatcgtggtcgggctgatcggcgaacgcggccgcgaagtgcgcgatttc
gtcgagaccacgctgggcgaggaaggcctgcgccgcgccgtggtcgtggccgcgccggcc
gaccgcccaccgctggcgcgcctgcacggcgcctaccgcgccactgcgatcgctgaatgg
ttccgcgaccagggcctgaacgtgctgctgctgatggattcgctgacccgcttcgcccag
gcgcagcgcgagatcggcctgtcggtcggcgagccgccgaccacccgcggctacccgccg
tcggtgttcgccaagctgccggcgctggtcgagcgcgccggcaacggcgccaagggccgc
ggctcgatcaccgcgttctacaccgtgctgaccgaaggcgacgatccgcaggacccgatc
gccgacgccgcccgcgccatcctcgacggccacatcctgctgtcgcgccgcgtcgccgac
agcggcctgtatccggccatcgacgtggaatcctcggtcagccgcgtggtccaggacatc
gccgacgagccgtggcggctgcgcatccgcgcgctgaagcggctggtctcggcgtactcg
gccaaccgcgacctgatcaccatcggcgcctaccagcgcggcaacgatgcggccgtggac
gaagcgctggagcgctggccggagatcatggaattcctcggacaggatgtcgccaaggcc
gcagatctgccccacagccaggccgcgttgaagcgcctggtcgaacgtgagaactaa

DBGET integrated database retrieval system