Xanthomonas translucens pv. undulosa: FD63_15330 Help Entry FD63_15330        CDS       T03961                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xtn  Xanthomonas translucens pv. undulosa Pathway xtn00290   Valine, leucine and isoleucine biosynthesis xtn00650   Butanoate metabolism xtn00660   C5-Branched dibasic acid metabolism xtn00770   Pantothenate and CoA biosynthesis xtn01100   Metabolic pathways xtn01110   Biosynthesis of secondary metabolites xtn01210   2-Oxocarboxylic acid metabolism xtn01230   Biosynthesis of amino acids Module xtn_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xtn_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xtn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     FD63_15330    00660 C5-Branched dibasic acid metabolism     FD63_15330   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     FD63_15330   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     FD63_15330 Enzymes [BR:xtn01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      FD63_15330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  AKK68745 LinkDB All DBs Position 3548381..3548629 Genome browser AA seq 82 aa AA seqDB search MRYQLDLVLKPVEGALLRAIGMAERRGFAPLSIRGAPAPDDAGRWHLQMVVDGTRPGESL RLQMEKVYDCESVRVTALDVAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgataccagcttgacctggtgctgaagccggtcgaaggcgcgctgctgcgggcgatc ggcatggccgagcggcgcggcttcgcgccgctgtcgatccgcggcgcgccggcgcccgac gacgccggccgctggcacctgcagatggtggtggacggcactcgccccggcgagagcctg cgcctgcagatggagaaggtgtacgactgtgagtcggtgcgggtcactgcgctggatgtg gcgtcatga

DBGET integrated database retrieval system