Xanthomonas translucens pv. undulosa: FD63_18930 Help Entry FD63_18930        CDS       T03961                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xtn  Xanthomonas translucens pv. undulosa Pathway xtn01100   Metabolic pathways xtn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xtn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FD63_18930    00074 Mycolic acid biosynthesis     FD63_18930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FD63_18930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKK69391 LinkDB All DBs Position complement(4375474..4375743) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPGDIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVEANKTS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcaaaccgccgccgaacgtgaattggccgagctgctggtcgagagcctgaac ctggaggacgtgcagcccggcgacatcgatccagaagcgccgctgttcaataccgggctg ggcctggactcgatcgacgcgctggagctggcgctggcgatcagcaagcgctacggcttc cagttgcgctcggacaacgacgagaaccgccgcatcttcgcctcgctgcgcgcattgtcg gcgcatgtcgaagccaacaagaccagctga

DBGET integrated database retrieval system