KEGG   Xenopus tropicalis (tropical clawed frog): 100496791
Entry
100496791         CDS       T01011                                 
Symbol
tnfrsf8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100496791 (tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:xtr04050]
    100496791 (tnfrsf8)
   04090 CD molecules [BR:xtr04090]
    100496791 (tnfrsf8)
Cytokine receptors [BR:xtr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100496791 (tnfrsf8)
CD molecules [BR:xtr04090]
 Proteins
  100496791 (tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Other DBs
NCBI-GeneID: 100496791
NCBI-ProteinID: XP_012822552
Xenbase: XB-GENE-990269
LinkDB
Position
7:66107547..66139832
AA seq 608 aa
MAMHVDHETLEEYKEKTGHERPTSALEEYLKQKQTWKNSHPAFSQNYTLMPLEQLQMVRI
HRACARPCNKESPRDIVLKFYYEATRDAALQAACLLTSSLFTYIYKLPADIFADLAPTTL
QKRRQMKEVAQILQKAKIKYRWGFPFMLHCIINNRYYTFKTADTALLALGKEDLTAPLLA
TSTTNSPRPHSEWQVTKAEINCLNSKYYNDTLNQWCCNCNQDFVKRYPCVTDERRHCMKP
CSKGYYINWEEAIPQCAACVTCSKDHDLIEKQKCSLQSAAICECQPGFYCTLPSINTCAR
CRPHLKCKPGFGVKKKGTAKSDTECEECPNGTYSNISSAKEGCIPHTESATQIVHKQREA
TETLLSLNFSPSTEAASKNPSTVPHPGNTVSNPVKMQITTEPLVTTKKLDTEIPVYVVAA
IICSTILVIYFLFLWKQVLCKGEQCLLNKNGLASCSFCFGKMTTFFNHIEESKETMFFGK
ENESKVQTLALESKSCLKEASVPMEKEWLVEEKTDMQSSDQMNNRIEKIYIMKAETVVVG
SRQISVSTDSESQSANYQDNTILASHYPEQESSKVSPNELMLSIEEEGKAFIDTEEDTVN
ISVKSTVN
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggccatgcacgtggaccatgaaactcttgaagaatataaagagaaaacaggtcacgaa
aggccaacctccgccttagaggagtacctgaaacagaaacagacctggaaaaattcgcat
ccagccttttctcaaaactacacccttatgcccctggagcaattacaaatggtccggata
catagagcatgtgcaagaccttgcaataaagaatccccaagggacattgtacttaaattc
tattacgaagccaccagggatgcggccctacaagcagcttgtttacttacaagcagcttg
tttacttacatttacaaactacctgcagacatatttgctgacctcgctcccaccacgctc
caaaaaaggaggcagatgaaggaggtagcccaaattctgcaaaaagcaaagatcaaatac
agatggggcttccctttcatgcttcactgtatcattaacaacaggtactacacctttaaa
acagcagatacagctctcctagccctaggaaaagaagacctcactgcaccattgctagcg
acatcgaccactaacagcccgagaccacacagcgaatggcaagtcaccaaggcagaaata
aactgtttaaactccaaatattacaatgacacattgaatcaatggtgctgtaattgcaac
caagattttgtgaagcgctatccatgtgttacagatgaaaggagacattgcatgaagcca
tgttccaaggggtattatattaattgggaagaagctatacctcaatgtgcagcttgtgta
acatgctctaaagatcatgatcttatcgaaaagcaaaaatgctccttacaaagtgcagca
atttgtgagtgtcagcctggattttattgtactctgccctcaattaacacttgtgccaga
tgccgccctcatctgaaatgcaaacctggatttggtgtcaagaagaaaggtacggcaaaa
agtgacacagaatgtgaagagtgccctaatggtacttactcaaacatttcttcagcaaaa
gaagggtgcatacctcacacagaatcagcaactcagattgttcataagcaaagagaagct
actgaaacactgctgtctctcaacttcagtccatcgacagaagcagcaagtaaaaatcca
tcaacggttccacatcctggaaacaccgtatcaaacccagtaaaaatgcagattactact
gagccactggttacaactaagaaattagatacagagatacctgtctacgtggtggctgcc
attatatgcagtacaatcttggttatatacttcttatttctctggaagcaagtgttatgt
aaaggggaacagtgtttgttaaacaagaatggacttgcctcatgcagcttctgctttggt
aagatgaccaccttttttaaccacattgaagagagcaaggaaactatgttttttggcaaa
gaaaatgaatctaaagtacaaacattagctctggaaagtaaatcttgtttaaaagaagca
tctgtaccaatggagaaggagtggttggtggaagaaaaaactgatatgcaaagcagtgat
cagatgaataacagaattgaaaaaatctacataatgaaagcagaaacagttgttgtgggg
tccagacaaatatctgtatcaactgatagcgaaagtcagtcagcaaactatcaagataat
acaatattggcttcacattaccctgagcaggaatccagcaaagtttcaccaaatgaactt
atgctttctattgaagaggaaggaaaagcatttattgacactgaagaggatactgtcaat
ataagtgttaagagtactgttaattaa

DBGET integrated database retrieval system