Xylella taiwanensis: AB672_01600
Help
Entry
AB672_01600 CDS
T05568
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
xtw
Xylella taiwanensis
Pathway
xtw00770
Pantothenate and CoA biosynthesis
xtw01100
Metabolic pathways
xtw01240
Biosynthesis of cofactors
Module
xtw_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
xtw00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
AB672_01600
Enzymes [BR:
xtw01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
AB672_01600
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AXI82749
UniProt:
Z9JL81
LinkDB
All DBs
Position
412978..413466
Genome browser
AA seq
162 aa
AA seq
DB search
MTVVNRRIAVYPGTFDPITNGHIDLVNRAAPLFETVVVGVAQSPSKGPSLPLQQRVTLAR
EALDQHANVQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL
FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQSF
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgaccgtggtcaatcgccgcatcgctgtttatcctggcaccttcgacccgatcaccaat
ggtcacattgatttagtgaatcgagcggctccgttgttcgagacggttgtggtgggtgtt
gcgcagagtccatccaagggcccttcgttgccgttgcagcagcgtgtgactctagcgcgt
gaagcgttggaccagcatgcgaatgtccaggtcattgggttcgatacattgctggcgcat
ttcgtgcgtcacgttggcgctggtgtgttgctgcgtggcttacgtgctgtttcggatttc
gagtacgagttccagatggcgagcatgaatcgtcatctgattcctgaagttgagacattg
tttctgactccagcggagcagcacagctttatttcgtcctcgctggtgcgcgagatcgcg
cggcttggtggggatgtttctggctttgcacctgctgcggtggtcgcagcgttgcggcag
agtttctag
DBGET
integrated database retrieval system