Xylella taiwanensis: AB672_04070 Help Entry AB672_04070       CDS       T05568                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xtw  Xylella taiwanensis Pathway xtw01100   Metabolic pathways xtw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xtw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB672_04070    00074 Mycolic acid biosynthesis     AB672_04070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB672_04070 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB Motif Other DBs NCBI-ProteinID:  AXI83171 LinkDB All DBs Position 959100..959339 Genome browser AA seq 79 aa AA seqDB search MSDIEARVRKIVAEKLNVDEEKVTNTSTFVDELGADSLDTVELVMALEDEFQCEIGDEAA EKMTSVQHAIDYIKSNAKC NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgaagcgcgcgtcagaaaaattgtcgccgagaaactcaatgtcgatgaa gaaaaagtgactaatacctcgacgttcgtcgatgaactgggtgcggattcgctggatacc gtcgagttggtgatggccttggaagacgaattccagtgtgagatcggcgacgaggctgct gagaagatgacttcggtgcaacatgccatcgactacattaagtctaatgccaagtgctaa

DBGET integrated database retrieval system