Xylella taiwanensis: AB672_11595 Help Entry AB672_11595       CDS       T05568                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xtw  Xylella taiwanensis Pathway xtw01100   Metabolic pathways xtw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xtw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB672_11595    00074 Mycolic acid biosynthesis     AB672_11595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB672_11595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXI84520 UniProt:  Z9JNJ4 LinkDB All DBs Position complement(2766685..2766954) Genome browser AA seq 89 aa AA seqDB search MSVQTPAERELAELLVESLNLEDVQPGDIDPTAPLFNTGLGLDSIDALELALVITKRYGF QIRSDHDDNQRIFASLRALSDHVQAHRST NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgtgcaaactcctgctgagcgcgaactggctgagttactggttgaaagtctcaat cttgaggatgtccaacccggggatatcgatccgacagcaccgttgttcaacacggggttg ggcctggattcgattgatgcgctcgaattggctctggtgattaccaagcgttatggtttc cagatacgttcggatcatgacgacaaccaacgtatcttcgcttcgctgcgtgcgctttca gatcatgtccaagcgcatagaagtacctga

DBGET integrated database retrieval system