Xanthomonas vasicola pv. vasculorum: C7V42_00300 Help Entry C7V42_00300       CDS       T05388                                  Name (GenBank) NAD(P)H dehydrogenase   KO K00355   NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2] Organism xva  Xanthomonas vasicola pv. vasculorum Pathway xva00130   Ubiquinone and other terpenoid-quinone biosynthesis xva01100   Metabolic pathways xva01110   Biosynthesis of secondary metabolites xva01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:xva00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00130 Ubiquinone and other terpenoid-quinone biosynthesis     C7V42_00300 Enzymes [BR:xva01000]  1. Oxidoreductases   1.6  Acting on NADH or NADPH    1.6.5  With a quinone or similar compound as acceptor     1.6.5.2  NAD(P)H dehydrogenase (quinone)      C7V42_00300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flavodoxin_2 FMN_red Flavodoxin_4 Motif Other DBs NCBI-ProteinID:  AVQ05336 UniProt:  A0AAE8F7W6 LinkDB All DBs Position complement(70690..71013) Genome browser AA seq 107 aa AA seqDB search MQLHRGQHGAGQRSLTHAIAAQVSAGLEEAAADHAVELADLAQEGFDPRFTQADVALFQQ QPAPPPDVAAEHARLDGADALLLVFPIYWCLFPALLKGRIDRMFTLG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcagctgcaccgtggtcagcatggtgccgggcagcgctcgctgacgcacgccattgcc gcgcaggtgagcgcgggacttgaggaggccgccgctgaccacgcggtcgagctggccgac ctggcgcaggaaggcttcgatccgcgctttacccaggccgacgtcgcgctgtttcagcag caacctgcaccgccgccagatgtggcggctgaacacgcgcggctggatggcgccgatgcg ctgctgctggtgttcccgatttactggtgcttgtttcctgcactgctaaaaggccggatc gatcggatgtttacgctgggctag

DBGET integrated database retrieval system