Xanthomonas vasicola pv. vasculorum: C7V42_20955 Help Entry C7V42_20955       CDS       T05388                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xva  Xanthomonas vasicola pv. vasculorum Pathway xva00998   Biosynthesis of various antibiotics xva01100   Metabolic pathways xva01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xva00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7V42_20955    00074 Mycolic acid biosynthesis     C7V42_20955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7V42_20955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVQ08700 UniProt:  A0AAE8JY11 LinkDB All DBs Position complement(4585603..4585872) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLIESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDSDENRRIFASLRALSAHVQANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctgatcgaaagtctgaac ctggaagacgtccaacccgccgacatcgatccggaggcgccgttgttcaacaccgggctg gggttggactcgatcgatgcgctggaactggcgctggcgatcagcaagcgctacggcttc cagctgcgttcggacagcgacgagaaccgtcgcatcttcgcgtcgctgcgcgcattgtcg gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system