Xanthomonas vesicatoria: BJD12_02745 Help Entry BJD12_02745       CDS       T04741                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism xve  Xanthomonas vesicatoria Pathway xve00190   Oxidative phosphorylation xve01100   Metabolic pathways xve02020   Two-component system Module xve_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:xve00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BJD12_02745  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BJD12_02745 Enzymes [BR:xve01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BJD12_02745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB MFS_1 Motif Other DBs NCBI-ProteinID:  APP74353 UniProt:  F0BJ79 LinkDB All DBs Position 627080..627196 Genome browser AA seq 38 aa AA seqDB search MWYFAWILGTGLAALAAVLNGMWFEAREPERAHQPQEK NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcctggattctcggcaccggtctggcggcattggccgcggtgctcaac ggcatgtggttcgaagcgcgcgagcccgagcgcgcgcatcagccgcaggaaaaataa

DBGET integrated database retrieval system