Xanthomonas vesicatoria: BJD12_08260 Help Entry BJD12_08260       CDS       T04741                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xve  Xanthomonas vesicatoria Pathway xve00290   Valine, leucine and isoleucine biosynthesis xve00650   Butanoate metabolism xve00660   C5-Branched dibasic acid metabolism xve00770   Pantothenate and CoA biosynthesis xve01100   Metabolic pathways xve01110   Biosynthesis of secondary metabolites xve01210   2-Oxocarboxylic acid metabolism xve01230   Biosynthesis of amino acids Module xve_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xve_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xve00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BJD12_08260    00660 C5-Branched dibasic acid metabolism     BJD12_08260   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BJD12_08260   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BJD12_08260 Enzymes [BR:xve01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BJD12_08260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  APP75242 UniProt:  F0BBM6 LinkDB All DBs Position 1909659..1909916 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGGAAPDDAGRWHLQLDVDSNRPAETL RLQLEKVYDCESVVITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgacctggtgctgaagccggccgaaggcgcattggtgcgggtgatc ggcatgaccgagcgccgcgggtttcgcccgtgcgccattcaaggcggggcagcgcccgat gatgccgggcgctggcatctgcaactggacgtggacagcaaccggccagcggaaacgctg cgcctgcagctggaaaaggtgtacgactgcgagtcggtggtaatcacggcgctggaatcg gtcgaggctgccgcatga

DBGET integrated database retrieval system