Xylophilus sp. GOD-11R: R9X41_16870 Help Entry R9X41_16870       CDS       T09600                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism xyg  Xylophilus sp. GOD-11R Brite KEGG Orthology (KO) [BR:xyg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xyg03036]     R9X41_16870    03400 DNA repair and recombination proteins [BR:xyg03400]     R9X41_16870 Chromosome and associated proteins [BR:xyg03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     R9X41_16870 DNA repair and recombination proteins [BR:xyg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       R9X41_16870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  WPB55805 LinkDB All DBs Position complement(3637013..3637312) Genome browser AA seq 99 aa AA seqDB search MSSYQELLARQKALEEQIEAAHGRERETAIEEVRRIAADFGLGELELFGRSISRGGVSET AGRPLLAKYKDPETAKTWTGRGKPPSWIAGKDREPFLIR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagcagctaccaggaacttctggcgcgccagaaagcactcgaggaacagatcgaggcg gcacacggccgcgaacgcgagactgcgatcgaggaagtgcggcgcatcgccgccgatttc ggcctgggcgagctggagctcttcggccgcagcatcagccgcggcggcgtgagcgagacc gccggccgcccgctgctggccaagtacaaggaccccgagaccgccaagacctggactggc cggggcaagccgccgagctggatcgcgggcaaggatcgcgagcctttcctgatccgctga

DBGET integrated database retrieval system