Xylophilus sp. GOD-11R: R9X41_20905 Help Entry R9X41_20905       CDS       T09600                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism xyg  Xylophilus sp. GOD-11R Brite KEGG Orthology (KO) [BR:xyg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:xyg03110]     R9X41_20905 (grxC) Chaperones and folding catalysts [BR:xyg03110]  Protein folding catalysts   Protein disulfide isomerase    R9X41_20905 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  WPB56572 LinkDB All DBs Position complement(4555130..4555390) Genome browser AA seq 86 aa AA seqDB search MQNVTMYTTAVCPYCIRAKQILKSKGVEEIHEIRIDSDPAARAAMMERTGRRTVPQIFIG ETHVGGCDDLMALDGRGGLTALLQPA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaaaacgtcaccatgtacacgacggccgtttgcccttattgcattcgcgccaagcag atcctcaagtccaagggcgtggaagaaatccacgagatccggatcgattccgacccggcc gcccgcgccgcgatgatggagcgcaccggtcgccgcaccgtgccgcaaatcttcatcggt gaaacccacgtcggtggctgcgacgacctcatggccctcgacggccgcgggggcctgacg gccctgctgcagcctgcctga

DBGET integrated database retrieval system