Xylophilus sp. GOD-11R: R9X41_21580
Help
Entry
R9X41_21580 CDS
T09600
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
xyg
Xylophilus sp. GOD-11R
Pathway
xyg03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
xyg00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
R9X41_21580 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
xyg03011
]
R9X41_21580 (rplR)
Ribosome [BR:
xyg03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
R9X41_21580 (rplR)
Bacteria
R9X41_21580 (rplR)
Archaea
R9X41_21580 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
WPB56700
LinkDB
All DBs
Position
complement(4681274..4681642)
Genome browser
AA seq
122 aa
AA seq
DB search
MSLTKKEQRLRRSRQTRIRIALQGVPRLTVNRTNLHIYATVISGDGTKVLASASTAEASV
RSELGGSGKGGNAAAATAIGKRIAEKAKAAGVEKVAFDRAGFAYHGRVKALADAAREAGL
QF
NT seq
369 nt
NT seq
+upstream
nt +downstream
nt
atgtctttgaccaagaaagagcagcgtcttcgtcgttcgcgccagacccgcatccgcatt
gccctgcaaggcgttccgcgtctgaccgtgaaccgcaccaacctgcacatctacgctacc
gtgatctcgggcgacggcaccaaggtgctggcatccgcctcgacggcagaggcctcggtt
cgttcggaactcggtggttccggcaagggcggcaacgccgctgccgcgactgccatcggc
aagcgcatagccgagaaggccaaggccgccggtgtcgagaaggtcgctttcgaccgcgct
ggtttcgcctatcacggccgcgtcaaggcgctggctgacgctgcccgcgaagcgggtctg
cagttctaa
DBGET
integrated database retrieval system