Xylophilus rhododendri: GT347_16475 Help Entry GT347_16475       CDS       T06383                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism xyk  Xylophilus rhododendri Brite KEGG Orthology (KO) [BR:xyk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:xyk03110]     GT347_16475 (grxC) Chaperones and folding catalysts [BR:xyk03110]  Protein folding catalysts   Protein disulfide isomerase    GT347_16475 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QHI99433 UniProt:  A0A857J894 LinkDB All DBs Position 3554848..3555108 Genome browser AA seq 86 aa AA seqDB search MKNVTMYTTAVCPYCIRAKQILKARGVDKIEEIRIDTDPAARATMMERTGRRTVPQIYVG DTHVGGCDDLMALDGRGGLVPLLQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaagaacgtcaccatgtacacgacggccgtgtgtccttactgcatccgcgccaagcag atcctgaaggcgcgcggcgtggacaagatcgaggagatccgtatcgatacggatcccgcc gcccgcgccaccatgatggagcgcaccggccggcgcaccgtgccgcagatctatgtcggc gacacccatgtcggcggctgcgacgacctgatggcgctcgatggccgtggcgggctggtg ccgctgctgcaggcggcctga

DBGET integrated database retrieval system