Xylanimonas allomyrinae: ET495_16615 Help Entry ET495_16615       CDS       T05814                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism xyl  Xylanimonas allomyrinae Brite KEGG Orthology (KO) [BR:xyl00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     ET495_16615 Enzymes [BR:xyl01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      ET495_16615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Glrx-like Thioredoxin Motif Other DBs NCBI-ProteinID:  QAY64557 UniProt:  A0A4P6EVN1 LinkDB All DBs Position complement(3671306..3671575) Genome browser AA seq 89 aa AA seqDB search MTGATPTLPDPGTITMYSTTWCGYCRRLRTQLDSVGIGYTVIDIEERPETAAFVEQVNGG NRTVPTVVYPDGTAATNPSLADVKKALAS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccggcgccaccccgacactgcccgaccccggcaccatcacgatgtactcgaccacc tggtgcgggtactgccgccgcctgcgcacccagctcgactctgtcggcatcggttacacc gtgatcgacatcgaggagcggcccgagacggcggcgttcgtcgagcaggtcaacggaggc aaccgcaccgtgcccaccgtcgtctacccggacggcaccgcggcgaccaacccgtcgctc gccgacgtcaagaaggcgctcgcgtcgtaa

DBGET integrated database retrieval system